SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0010s14270.1|PACid:18242247 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0010s14270.1|PACid:18242247
Domain Number 1 Region: 51-142,287-330,359-419,908-1137
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.62e-51
Family Calcium ATPase, transmembrane domain M 0.024
Further Details:      
 
Domain Number 2 Region: 413-437,646-766,833-903
Classification Level Classification E-value
Superfamily HAD-like 5.77e-32
Family Meta-cation ATPase, catalytic domain P 0.061
Further Details:      
 
Domain Number 3 Region: 494-697
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 2.4e-22
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0075
Further Details:      
 
Domain Number 4 Region: 142-210,245-285
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.22e-16
Family Calcium ATPase, transduction domain A 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0010s14270.1|PACid:18242247
Sequence length 1194
Sequence
MAGGGKRKRLSLSKLYSFACGKTSLKGDQSQMGAPGFSRVVHCNEPDCFEAKIRRYSGNY
VSTTKYNVATFLPKSLFEQFRRVANFYFLVVGILAFTPLAPYTAVSAIFPLIVVVGATMV
KEGIEDWKRAQQDIEMNNRKTRVHQGDGTFKSTGWKNLRVGDIVKVKKDEYFPADLLLLS
STFEDGICYVETMNLDGETNLKLKQALEATAFMHEDSYYRDFKALIKCEDPNTNLYSFVG
TLDFEQNLYPLSPQRLLLRDSKLRNTEYIYGAVIFTGHDTKVMQNSTAPPSKRSKFEKQM
DKIVYFLFFVLFMMAFIGSLVFGVATDNDLDGGRMKRWYLKPDESTVYFDPKRVVLASIC
HFLTALMLYNYFIPISLYVSIEVVKVFQSSFINNDINLYYEPSDRPAHSRTSNLNEELGQ
VDTILSDKTGTLTCNSMEFIKCSVAGTAYGHGVTEAERGMGVREGESVNGWDQSKDSSTT
KPHIKGFNFKDERIMDGNWVHEPQANIIENFFLLLAICHTAIPDVDEETGKISYEAESPD
EAAFVIAAREIGFEFYKRTQTSVAVREYNPKTGKKVERVYTVLNVLEFNSARKRMSVIVR
NEEGKLLLLCKGADSVMFERLAKSGRGFEEETKNHVNDYADSGLRTLILAYRELAEEEYK
IFNQKFTEAKNSVSADRETLIDDMAEKIERNLVLLGATAVEDKLQEGVPACIDKLAQAGI
KMWVLTGDKMETAINIGFSCCLLRQGMKQIIINLENPEILSLEKTGNKDAITKASRESVL
RQITDGTALLTGPSGTAETFALIIDGKSLAYALEDDMKHLFLDLAMSCASVICCRSSPKQ
KALVTRLVKSGTRKTTLAIGDGANDVGMLQEADIGVGISGVEGMQAAMASDVAIAQFRYL
ERLLLVHGHWCYRRLSSMICYFFYKNIAFGFSIWLYEAYTSFSAQSVYGDWFLSFYNVFF
TALPVAALGIFEQDVSAASCLKYPLLYQEGVKNLLFGWRRVLHWLGNGFYTALVVFFFCS
TALQHQAFNRDGKTVGMDVLGGTMYTCIVWAVNLQMALTVCYFTKIQRGLIIYCLCMLYI
FFVAFGSLSPSMSAIGYKLFTEALAPAASYWFTIIFVIIAALLPFYAYSAIETRFFPMYH
QMIQRLESGKHEDDPEYCDMMRQKLLQPPTSVGFSARLAARANKLRRKNKNQPQ
Download sequence
Identical sequences B9HWP6
XP_002314900.2.11743 POPTR_0010s14270.1|PACid:18242247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]