SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0010s16780.1|PACid:18240760 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0010s16780.1|PACid:18240760
Domain Number 1 Region: 177-245
Classification Level Classification E-value
Superfamily SNARE fusion complex 9.68e-16
Family SNARE fusion complex 0.0011
Further Details:      
 
Domain Number 2 Region: 80-118
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000393
Family SNARE fusion complex 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0010s16780.1|PACid:18240760
Sequence length 247
Sequence
MFGFGKSPANNKATKQSSVNPPASSTSNPFDSDDESNAKQTLHLGKRASSESMLNVLDNA
FDDKDRYKNDFRDSGGLENQSVQELEKYAAYKAEETTNSVNNCLRIAEDIKQDATRTLDS
RYAACSGMGEKLLNNLGGIFSKPWKPKKTRDITEPLITAAPKGRSAITTPPPEPTNALQE
VEVEKAKQDDALSDLSNILGDLKGTAVDMGSELDRQNKALDHLGDDVDELNSRVKGANQR
TRHLLGK
Download sequence
Identical sequences B9HY38
XP_002316150.2.11743 POPTR_0010s16780.1|PACid:18240760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]