SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0010s17150.1|PACid:18240036 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0010s17150.1|PACid:18240036
Domain Number 1 Region: 6-94
Classification Level Classification E-value
Superfamily t-snare proteins 9.42e-24
Family t-snare proteins 0.00066
Further Details:      
 
Domain Number 2 Region: 131-190
Classification Level Classification E-value
Superfamily SNARE fusion complex 1.57e-17
Family SNARE fusion complex 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0010s17150.1|PACid:18240036
Sequence length 223
Sequence
MSEVFEGYERQYCELSANLSRKCNSTSLLPDGVEKNAKVNEIKSGLDDCDVLIRKMDLEA
RSLQPNVKAMLLAKLREYKSDLNKLKREFKRITSGDVNQASRVELLEAGMADVHSVSADQ
RERMTMSVERLNQSGDRIKESRRTMLETEELGVSILEDLHQQRQTLLHAHNKLHGVDDAI
DKSKKVLTSMLRRMTRNKWIVGSVIAALVVAIIFIILFKISHH
Download sequence
Identical sequences B9HXP4
3694.estExt_fgenesh4_pm.C_LG_X0632 POPTR_0010s17150.1|PACid:18240036 XP_002315029.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]