SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0010s19500.1|PACid:18241939 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0010s19500.1|PACid:18241939
Domain Number 1 Region: 136-168,197-237,268-306,335-342,514-588,618-682
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.2e-25
Family WD40-repeat 0.026
Further Details:      
 
Domain Number 2 Region: 1075-1125
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000000324
Family SNARE fusion complex 0.0034
Further Details:      
 
Domain Number 3 Region: 10-50
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000837
Family beta-sandwich domain of Sec23/24 0.027
Further Details:      
 
Weak hits

Sequence:  POPTR_0010s19500.1|PACid:18241939
Domain Number - Region: 68-173
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0228
Family Quinoprotein alcohol dehydrogenase-like 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0010s19500.1|PACid:18241939
Sequence length 1133
Sequence
MFSKLFQRNTSQQPPPPPQQQPPPQPQPQPQPQPQPPPTPPPAEVQDNVSKGVLTPKDIN
PRIALHYGIPSTASILAFDHIQSLLAIGTLDGRIKVIGGNNIEGLLVSPKQSPFKYLEFL
QNQGFLVSVSNENEIQTDCFLFTITAFSVIFCSSYMYVGDEYGMVYVLKYDAEEVKLVPM
PYHVPADVAADASGMSSPKNRSVVGVLPQPSSQGNKVLIAYEDGLIIIWDVSEDKVVLVK
GNKDLELKCKITADSHKDTGPELSDDISDYQPLEKEIAALCWASTDGSVLAVGYVDGDIL
LWNLSSTTSAKDMHAAKSSNDVVKLLLSTGDRRLPVIVLHWSAHRSHNDCRGRLFVYGGD
AIGSEEALTILSLDWSSGIESLKCTGRVDLTLNGSFADMVLLPSGGDMGTSSTLILTNPG
QLNLYNDAGLSSSISLLEKRNYVSSIQYPMVIPTIEPQLTLAKLGLVFRDGKFSKALSEE
ISSRKLQATHCPRSTNWPLTGGVPSQLQDAEKYQVERLYMAGYQDGTVKIWDATYPTFAL
IYVLGPEVKGINVADADANASVSALEFCSDTLSLAIGNERGMVRLYKLVRSADEMTLKFV
TGTEKEGITLFYTLDQGDGPQCTAVFSFLSSPINALQFANFGTRLAVGFHCSQVALLDTS
TSSVLFLTDSLSGSNSPITSLAVRLFSDSSDLINNREDTESKTMEDHVRLEVFVMTKDAH
TVVIDGNTEDIFNCCLRIVWISENFLHAEGDYLISEMSRGKHVSNSSQKSEAKSEPVPDV
ACSESAPLKVDHEASAKASHFKQRVENFLLLFCCEDALDLYSLNEVDINPIRKVNLMKPC
CWSTQFKKDDKDCGVILLYQTGEIEIRSLPDLEVVGESSLMSILRWNFKTNMEKTICSSE
NAQIILVNGCEFAAISLLACENDFRIPESLPSLHDKLLTAAADATISFSPNQKITQGASS
GILGGLVKGFQGSMAEHDVDLFEVCKNNFAHLEGIFSSPPFLKPSIDLVDDQKVVELRID
DIDIDEPLFVSSSSEMMSKNDTKDRGTERERLFEGASTDSQPKLKTADEIKAKYRKEDVS
AVAARAKDKLIQRQEKLERLSERTAELQSGAENFGSMANELAKQMEKRKWWNI
Download sequence
Identical sequences B9HSM7
POPTR_0010s19500.1|PACid:18241939 XP_002315153.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]