SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0010s19500.2|PACid:18241940 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0010s19500.2|PACid:18241940
Domain Number 1 Region: 136-168,197-237,268-306,335-342,514-678
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.93e-25
Family WD40-repeat 0.026
Further Details:      
 
Domain Number 2 Region: 1071-1121
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000000324
Family SNARE fusion complex 0.0034
Further Details:      
 
Domain Number 3 Region: 10-50
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000837
Family beta-sandwich domain of Sec23/24 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0010s19500.2|PACid:18241940
Sequence length 1129
Sequence
MFSKLFQRNTSQQPPPPPQQQPPPQPQPQPQPQPQPPPTPPPAEVQDNVSKGVLTPKDIN
PRIALHYGIPSTASILAFDHIQSLLAIGTLDGRIKVIGGNNIEGLLVSPKQSPFKYLEFL
QNQGFLVSVSNENEIQTDCFLFTITAFSVIFCSSYMYVGDEYGMVYVLKYDAEEVKLVPM
PYHVPADVAADASGMSSPKNRSVVGVLPQPSSQGNKVLIAYEDGLIIIWDVSEDKVVLVK
GNKDLELKCKITADSHKDTGPELSDDISDYQPLEKEIAALCWASTDGSVLAVGYVDGDIL
LWNLSSTTSAKDMHAAKSSNDVVKLLLSTGDRRLPVIVLHWSAHRSHNDCRGRLFVYGGD
AIGSEEALTILSLDWSSGIESLKCTGRVDLTLNGSFADMVLLPSGGDMGTSSTLILTNPG
QLNLYNDAGLSSSISLLEKRNYVSSIQYPMVIPTIEPQLTLAKLGLVFRDGKFSKALSEE
ISSRKLQATHCPRSTNWPLTGGVPSQLQDAEKYQVERLYMAGYQDGTVKIWDATYPTFAL
IYVLGPEVKGINVADADANASVSALEFCSDTLSLAIGNERGMVRLYKLVRSADEMTLKFV
TGTEKEVYTLDQGDGPQCTAVFSFLSSPINALQFANFGTRLAVGFHCSQVALLDTSTSSV
LFLTDSLSGSNSPITSLAVRLFSDSSDLINNREDTESKTMEDHVRLEVFVMTKDAHTVVI
DGNTEDIFNCCLRIVWISENFLHAEGDYLISEMSRGKHVSNSSQKSEAKSEPVPDVACSE
SAPLKVDHEASAKASHFKQRVENFLLLFCCEDALDLYSLNEVDINPIRKVNLMKPCCWST
QFKKDDKDCGVILLYQTGEIEIRSLPDLEVVGESSLMSILRWNFKTNMEKTICSSENAQI
ILVNGCEFAAISLLACENDFRIPESLPSLHDKLLTAAADATISFSPNQKITQGASSGILG
GLVKGFQGSMAEHDVDLFEVCKNNFAHLEGIFSSPPFLKPSIDLVDDQKVVELRIDDIDI
DEPLFVSSSSEMMSKNDTKDRGTERERLFEGASTDSQPKLKTADEIKAKYRKEDVSAVAA
RAKDKLIQRQEKLERLSERTAELQSGAENFGSMANELAKQMEKRKWWNI
Download sequence
Identical sequences U5FZ18
POPTR_0010s19500.2|PACid:18241940 XP_006378656.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]