SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0010s22030.1|PACid:18241013 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0010s22030.1|PACid:18241013
Domain Number 1 Region: 53-277
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.46e-43
Family ABC transporter ATPase domain-like 0.00046
Further Details:      
 
Weak hits

Sequence:  POPTR_0010s22030.1|PACid:18241013
Domain Number - Region: 431-572
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0811
Family Calcium ATPase, transmembrane domain M 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0010s22030.1|PACid:18241013
Sequence length 686
Sequence
MLKRVGDVSREATGDGSETPVHQVLELGSTNLEVPRSIPFVLSFNKLTYSVKVRRESLFT
TTKTLLNDISGEARDGEILAVLGASGSGKSTLIDALANRIAKGSLKGTKTLNGEVLESRM
LKVISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSLSKSKKRLRVQALIEQLGLKNAAKT
VIGDEGHRGVSGGERRRVSIGIDIIHDPIILFLDEPTSGLDSTSAFMVVKVLQRIAQSGS
IVIMSVHQPSYRILGLLDRLIFLSRGQTVYSGSPMNLPVYFSDFGHPIPENENRTEFALD
LIRELEGSPGGTRSLVEFNKSWQDLKHSRNGGSEPDRGGLSLKEAISASISKGKLVSGAT
NNDAISPNSMVPTFANSVLIEMAVLSKRSFLNSRRMPELFGIRLGAVMVTGFILATMFWQ
LDNSPKGVQERLGFFAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHGL
VVLPSLIFLSLAFSATTFWAVGLDGGLSGFLFYFLIIFASFWAGSSFVTFLSGVVPHVML
GYTIVVAILAYFLLFSGFFINRDRIPAYWIWFHYLSLVKYPYEAVLLNEFQDPAKCFVRG
VQIFDQSPLGEVSTSLKLQLLESMSNTLGTKITSSTCLTTGADILLQQGITDLSKWNCLW
VTVAWGFLFRILFYISLLFGSKNKRR
Download sequence
Identical sequences B9HTY6
3694.fgenesh4_pm.C_LG_X000862 XP_002315262.1.11743 POPTR_0010s22030.1|PACid:18241013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]