SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0010s24630.2|PACid:18239829 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0010s24630.2|PACid:18239829
Domain Number 1 Region: 7-104
Classification Level Classification E-value
Superfamily SNARE-like 5.8e-24
Family Synatpobrevin N-terminal domain 0.0069
Further Details:      
 
Domain Number 2 Region: 144-210
Classification Level Classification E-value
Superfamily SNARE fusion complex 4.55e-23
Family SNARE fusion complex 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0010s24630.2|PACid:18239829
Sequence length 238
Sequence
MSSQKGLIYSFVAKGNVVLAEHTSYSGNFSTIAVQCLQKLPSNSSKYTYSSDGHTFNFLI
DNGFVFLVVADESVGRGVSFVFLERVKDDFNQRYGASIKNEAHPLADDDDDDDLFEDRFS
IAYNLDREFGPRLKEHMQYCVNHPEEISKLSKLKAQITEVKGIMMDNIDKVLDRGERIEL
LVDKTDNLSFQADSFQRQGRELRRKMWLQNLKVKLVLGGTVLALIVIVWISVCGGFKC
Download sequence
Identical sequences A9PGA3
XP_002315424.2.11743 XP_002315429.1.11743 POPTR_0010s24630.1|PACid:18239828 POPTR_0010s24630.2|PACid:18239829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]