SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0010s25240.1|PACid:18240260 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0010s25240.1|PACid:18240260
Domain Number 1 Region: 154-209,242-279
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.000000000000785
Family Calcium ATPase, transduction domain A 0.0095
Further Details:      
 
Domain Number 2 Region: 65-153
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000405
Family Calcium ATPase, transmembrane domain M 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0010s25240.1|PACid:18240260
Sequence length 304
Sequence
MDSQNPFEGEISLNQWKVGNSVREVSNGSRGGDLEMSGLSQKEIGDDDARLVYLNDPVKN
NERYEFAGNSIRTSKYPVFSFLPRNLFRQFHRVAYIYFLIIAVLNQLPQLAVFGRGASIM
PLAFVLSVTAVKDAYEDWRRQGSDRVENNRLACVLDIQVGEIIRIQKNETLPCDTVLLST
SEPTGVAYVQTVNLDGESNLKTRYAKQETLSKIPEKEMINGLIKRERPNRNIYGFQANIE
IEGKRLSLGPPNILLRGCELKNTAWAIGVAVYCGRETKAMLNSSGATSKRSRLEYNRTLD
VHKF
Download sequence
Identical sequences B9HVG8
XP_002315407.2.11743 POPTR_0010s25240.1|PACid:18240260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]