SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0010s25250.1|PACid:18240817 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0010s25250.1|PACid:18240817
Domain Number 1 Region: 31-118,260-308,335-395,870-1088
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.09e-50
Family Calcium ATPase, transmembrane domain M 0.034
Further Details:      
 
Domain Number 2 Region: 388-413,661-731,795-862
Classification Level Classification E-value
Superfamily HAD-like 4.51e-32
Family Meta-cation ATPase, catalytic domain P 0.058
Further Details:      
 
Domain Number 3 Region: 407-423,474-674
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 8.5e-17
Family Metal cation-transporting ATPase, ATP-binding domain N 0.011
Further Details:      
 
Domain Number 4 Region: 114-185,218-255
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 9.68e-17
Family Calcium ATPase, transduction domain A 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0010s25250.1|PACid:18240817
Sequence length 1122
Sequence
MFSASQKEISDEDARLVYLDDPAKSDERFEFAGNSIRTSKYSIISFIPRNLFEQFHRVAY
IYFLIIAVLNQLPQLAVFGRGASILPLAFVLLVTAVKDAYEDWRRHMSDRIENNRLAWVL
VNDQFQQKKWKDIQVGEIIKIQANDTLPCDMVLLSTSDSTGVAYVQTINLDGESNLKTRY
AKQDTLSKIPEKEKISGLIKCEKPNRNIYGFQANMDVDGKRLSLGPSNIILRGCELKNTV
WAIGVAVYCGRETKAMLNSSGAPSKRSWLESRMNSEIIVLSVFLIALCTVVSVSAAVWLR
RHRDELDTMPFYRRKDFSDGEPENYNYYGWVAEILFTFLMSVIVFQIMIPISLYISMELI
RVGQAYLMIRDTQMYDEASNSRFQCRALNINEDLGQIKYVFSDKTGTLTENKMEFQCASA
WGIDYSDGKVSTQNQQVRYSVEVEGRNVRPKMSVKVDPQLLELSKSGSDTEEVKHVHDFF
LALAACNTIVPLIVDDKSDPTAKLMDYQGESPDEQALAYAAAAYGFMLIERTSGHIIIDI
HGERQRFNVFGLHEFDSDRKRMSVILGCPDSTVRVFVKGADTSMFSVIDRSLNTKVVRAT
EGHLHTYSTLGLRTLVIGMRDLSDSEFEDWHFSFEAASTAVVGRAALLRKVASNVERNLT
ILGASAIEDKLQQGVPEAIESLRTAGIKVWVLTGDKQETAISIGYSSKLLTNKMTQIIIN
SNSRESCRRCLEDALVMSKKLRAVSETSDNTGTSSEAARGSVALIIDGTSLVYILDNELE
EQLFQLASTCSVVLCCRVAPLQKAGIVALVKKRTSEMTLSIGDGANDVSMIQMADVGVGI
SGQEGRQAVMASDFAMGQFRFLVPLLLVHGHWNYQRMGYMILYNFYRNAVFVFVLFWYAL
FACFTLTTAINEWSSMLYSIIYTSLPTIVVAILDKDLSRRNLLKYPQLYGAGQRQEAYNR
KLFWLKMLDTVWQSLVVFFVPIFAYWASTIDVPSIGDLWTLAVVILVNLHLAMDIIRWNW
IFHAVIWGSIVATFICVMILDAFPMFVGYWAIFHIMGEASFWVCLLGIIIAALLPRFVVK
VLYQHFTPDDLQIAREVEKFGHQRDMAVEVEMNPIMEPPPRR
Download sequence
Identical sequences B9HVG7
XP_002315406.1.11743 POPTR_0010s25250.1|PACid:18240817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]