SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0010s25730.1|PACid:18240465 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0010s25730.1|PACid:18240465
Domain Number 1 Region: 150-268,368-486,849-1063
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 6.93e-121
Family Calcium ATPase, transmembrane domain M 0.00086
Further Details:      
 
Domain Number 2 Region: 490-510,641-904
Classification Level Classification E-value
Superfamily HAD-like 1.24e-55
Family Meta-cation ATPase, catalytic domain P 0.0003
Further Details:      
 
Domain Number 3 Region: 499-696
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 4.9e-37
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0066
Further Details:      
 
Domain Number 4 Region: 270-365
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.12e-23
Family Calcium ATPase, transduction domain A 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0010s25730.1|PACid:18240465
Sequence length 1085
Sequence
MSSSCSSNGLLPSSASPREQDDLEARPTKEFEHDDHDLIDESDPFDIAQTKNAPIEILRQ
WRQAAFVLNACRRFRYTLDLKREDEKEKRRRMIRSHAQVVRIIRVNLFSASQVLGPSATP
PTATGDYAIELEQLASMTRDHNFSSLQQYGGAKGLSNMLKTNLVTGITGDENDLIKRRNA
FGTNRYPQKKGRSFLRFLWEAWQDLTLIILIVAAIASLGLGIKTEGLSHGWYDGASISFA
VILVIIVTAVSDYRQSLQFQNLNQEKQNIQLEVMRGGRTMKMSIFDIVVGDVVPLKIGDQ
VPADGLLITGHSLAIDESSMTGESKIVHKNQKAPFLMSGCKVADGFGTMLVTGVGINTEW
GLLMASVSEDTGEETPLQVRLNGLATFIGIVGLAVALSVLAVLLGRYFTGNTKNPDGSVQ
FIKGETKVSKAIDGVIKILTVAVTIVVVAVPEGLPLAVTLTLAYSMRKMMADKALVRRLS
ACETMGSSTTICSDKTGTLTLNQMTVVEAYIGKQKINPPDNPLKLHSEVSSLLCEGIAQN
TTGNVFVPKDGGDVEISGSPTEKAILSWAVKLGMKFDALRSESKILHVFPFNSEKKQGGV
AVQTTDSKVHIHWKGAAEMVLASCTRYLDSNGSLQSIDKDMDFFKASIDDMAACSLRCVA
IAYRPYDLDKVPTDVESLDKWVLPEDELVLLAIVGIKDPCRPGVKDAVRVCTAAGVKVRM
VTGDNIQTAKAIALECGILSSGADATEPNIIEGKVFRAYSEKEREIIAKKITVMGRSSPN
DKLLLVQALRKGGEVVAVTGDGTNDAPALHEADIGLSMGIQGTEVAKESSDIVILDDNFA
SVVKVVRWGRSVYANIQKFIQFQLTVNVGALVINVVAAVSSGDVPLNTVQLLWVNLIMDT
LGALALATEPPTDHLMHRTPVGRREPLITNIMWRNLLVQALYQVAVLLVLNFQGLSILNL
NQDDRKHATIVKNTMIFNAFVLCQVFNEFNARKPDQINVFKGVTKNRLFMGIVGFTVILQ
IILIEFTGDFTTTVRLNWKQWLICVAIGIVSWPLAAVGKLLPVPKTPLSKHFRKPFRRSR
TAWNA
Download sequence
Identical sequences B9HV37
POPTR_0010s25730.1|PACid:18240465 XP_002315383.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]