SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0011s05870.1|PACid:18231908 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0011s05870.1|PACid:18231908
Domain Number 1 Region: 5-101
Classification Level Classification E-value
Superfamily t-snare proteins 1.73e-28
Family t-snare proteins 0.00077
Further Details:      
 
Domain Number 2 Region: 153-216
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000109
Family SNARE fusion complex 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0011s05870.1|PACid:18231908
Sequence length 246
Sequence
MSSAQDPFYIVKEEIQESIDKLQSSFHQWERISCDMGDQVHLTKDLLAACESIEWQVDEL
DKAISVAGRDPSWYGIDEAELEKRRRWTSTARNQVGNVKKAVVAGREVNISGTASVSGMR
RELMRMPNSQQADKSNQYTQDNDDFIQSESDRQLLLIKQQDEELDELSITIGRLGGVGLT
IHEELLAQEKIIDDLGMEMDSTSNRLDFVQKKVATVMKKASAKGQLMMILFLVVLFIILF
VLVFLT
Download sequence
Identical sequences U5FVV6
POPTR_0011s05870.1|PACid:18231908 XP_006377433.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]