SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0012s01780.1|PACid:18229129 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0012s01780.1|PACid:18229129
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000941
Family Protein kinases, catalytic subunit 0.0065
Further Details:      
 
Weak hits

Sequence:  POPTR_0012s01780.1|PACid:18229129
Domain Number - Region: 81-140
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00214
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0012s01780.1|PACid:18229129
Sequence length 162
Sequence
CVKILNNSTGNGEEFINEVATMGKIHHVNVIRLVGYCADGFRRALVYDYLPNESLEKFVS
SEHGETSRRKTIDDKVENSNQIYFPEWVYNSLDKGEELRIRIEKEGDAQIAKKLTLVGLW
CIQWHPVDRPSMNTVVQMLEGEGDKLTMPPSPFASAEYHLVR
Download sequence
Identical sequences POPTR_0012s01780.1|PACid:18229129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]