SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0012s05450.1|PACid:18229069 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0012s05450.1|PACid:18229069
Domain Number 1 Region: 52-141,286-329,358-418,912-1141
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.4e-59
Family Calcium ATPase, transmembrane domain M 0.023
Further Details:      
 
Domain Number 2 Region: 412-436,650-756,837-908
Classification Level Classification E-value
Superfamily HAD-like 4.67e-35
Family Meta-cation ATPase, catalytic domain P 0.053
Further Details:      
 
Domain Number 3 Region: 498-700
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 3.27e-23
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0091
Further Details:      
 
Domain Number 4 Region: 144-209,244-284
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 9.42e-16
Family Calcium ATPase, transduction domain A 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0012s05450.1|PACid:18229069
Sequence length 1196
Sequence
MAGGRRKKQRFSRIHAFPCGRASFRSEHSLIGGPGFSRIVYCNEPECFEAGLQNYASNYV
RTTKYTLATFLPKSLFEQFRRVANFYFLLCAILSFTPLSPYSAISNVVPLVVVIGATMGK
EVIEDWRRKKQDIEMNNRKVKVHYGEGVFDHAKWMDLKVGDIVRVEKDEYFPADLILLSS
SYDEAICYVETTNLDGETNLKLKQAPDVTSNLHEDSGFQDFKAIIRCEDPNANLYSFIGS
LDLGEDQHALMPQQLLLRDSKLRNTDYIYGVVIFTGHDTKVMQNSTAPPSKRSKIEKRMD
KVIYLLFFLLVLISFIGSIFFGISTKEDLEDGRMKRWYLRPDKTTIYYDPHRAPAAAILH
FFTALMLYGYLIPISLYVSIEIVKVLQSIFINRDLHMYHEETDKPARARTSNLNEELGQV
DTILSDKTGTLTCNSMEFIKCSVAGTSYGRGVTEVEKDMARRKGSPLPQEETEEEDIVEG
VAEGKPSVKGFNFVDERITNGHWVNEPHADVVQKFLRLLAICHTAIPEIDEETGRISYEA
ESPDEAAFVIAARELGFKFYERTQTSILLHELDLVSGTKVERSYQLLNIIEFNSSRKRMS
VIVRNEKGKLLLLCKGADSVMFERLARDGREFEEPTREHIGEYADAGLRTLVLAYRELDE
EEYDEFNHEFTEAKNSLSADREDMIEEVAEKIERDLILLGATAVEDKLQNGVPECIDKLA
QAGIKIWVLTGDKMETAINIGFACSLLRQGMKQIIISSDTPENKALEKMEDKAAGVTALK
ASVVHQMNEGKALLTASSETSEALALIIDGKSLTYAIEDDVKNLFLELAIGCASVICCRS
SPKQKALVTRLVKSKTGKTTLAIGDGANDVGMLQEADIGVGISGVEGMQAVMSSDIAIAQ
FRFLERLLLVHGHWCYRRISSMICYFFYKNIAFGFTLFFYEAYASFSGQPAYNDWFLSLY
NVFFTSLPVIALGVFDQDVSARFCLKFPLLYQEGVQNVLFSWIRIFGWAFNGVSSAVLIF
FFCIRAMEHQAFRKGGEVVGLEILGATMYTCVVWVVNCQMALSINYFTYIQHLFIWGGIV
FWYIFLMVYGAMDPYLSTTAYKVFVEACAPAPSYWLITLLVLLSSLIPYFIYSAIQMRFF
PLYHQMIHWLRNDGQTEDPEYCNMVRQRSLRPTTVGYTARYVAKSKRLKEKKHQDR
Download sequence
Identical sequences B9I2N3
XP_002318557.2.11743 XP_006376746.1.11743 POPTR_0012s05450.1|PACid:18229069 POPTR_0012s05450.2|PACid:18229070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]