SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0012s06830.1|PACid:18230232 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0012s06830.1|PACid:18230232
Domain Number 1 Region: 101-171
Classification Level Classification E-value
Superfamily SNARE fusion complex 2.76e-17
Family SNARE fusion complex 0.0022
Further Details:      
 
Domain Number 2 Region: 240-299
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000027
Family SNARE fusion complex 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0012s06830.1|PACid:18230232
Sequence length 305
Sequence
MFGSKKSPLKISEHNKADPECPAPSRSNHFESENAVGTKKSLKPPRKTSSEPNLTSPNFR
TNPFDNDEERGLSSSSTYSLALSTRHKYKNDFLDLGGLENQPVQELENYAVYKAEETTKA
VNGCLKIAEEMREGATTTLITLHQQGEQITKTHSVAVEIDHDLSRGEKLLGSLGGMFSKT
WKPKKNRAIRGPVITRDASPRRRGNHLEQREKLGLNLAPKERSSTKTPLPETANAFQKVE
FEKSKQDDALSDLSNVIGELKNMAVDMGAEFDRQVGALDHVQDDVDELNSRLGGANKRGL
HLLRK
Download sequence
Identical sequences B9I2W3
POPTR_0012s06830.1|PACid:18230232 3694.eugene3.00120592 XP_002317966.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]