SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0012s06830.2|PACid:18230233 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0012s06830.2|PACid:18230233
Domain Number 1 Region: 101-171
Classification Level Classification E-value
Superfamily SNARE fusion complex 2.83e-17
Family SNARE fusion complex 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0012s06830.2|PACid:18230233
Sequence length 249
Sequence
MFGSKKSPLKISEHNKADPECPAPSRSNHFESENAVGTKKSLKPPRKTSSEPNLTSPNFR
TNPFDNDEERGLSSSSTYSLALSTRHKYKNDFLDLGGLENQPVQELENYAVYKAEETTKA
VNGCLKIAEEMREGATTTLITLHQQGEQITKTHSVAVEIDHDLSRGEKLLGSLGGMFSKT
WKPKKNRAIRGPVITRDASPRRRGNHLEQREKLGLNLAPKERSSTKTPLPETANAFQKVE
VCFYFVMCS
Download sequence
Identical sequences U5FXG5
XP_006376804.1.11743 POPTR_0012s06830.2|PACid:18230233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]