SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0012s07350.1|PACid:18230392 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0012s07350.1|PACid:18230392
Domain Number 1 Region: 17-134,241-335,649-863
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.92e-84
Family Calcium ATPase, transmembrane domain M 0.005
Further Details:      
 
Domain Number 2 Region: 337-393,422-647
Classification Level Classification E-value
Superfamily HAD-like 4.74e-38
Family Meta-cation ATPase, catalytic domain P 0.00081
Further Details:      
 
Domain Number 3 Region: 134-231
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 8.24e-29
Family Calcium ATPase, transduction domain A 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0012s07350.1|PACid:18230392
Sequence length 966
Sequence
MGDKGEVLEAVLKETVDLENIPIEEVLENLRCSREGLTTQAAEERLAIFGHNKLEEKKER
KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
AGNAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI
DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF
QKARRYNCYMIFVLTAIGNFCICSIAIGMVIELIVMYPIQDRKYRPGIDNLLVLLIGGIP
IAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLI
EVFAKGVDADAVVLMAARASRIENQDAIDTAIVGMLADPKEARAGIQEVHFLPFNPTDKR
TALTYIDSGGKMHRVSKGAPEQILNLSHNKSDIERRVHAVIDKFAERGLRSLAVAYQEVP
EGRKESAGGPWQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLG
MGTNMYPSSALLGQNKDESIAALPIDELIEKADGFAGVFPEHKYEIVKRLQARKHICGMT
GDGVNDAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYT
IYAVSITIRIVLGFMLLALIWKFDFPPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKL
AEIFTTGIVLGSYLAMMTVIFFWVAYKTDFFPRVFGVSTLEKTAHDDFRKLASAIYLQVS
TISQALIFVTRSRSWSFVERPGLLLVVAFIIAQLIATLIAVYANWSFAAIKGIGWGWAGV
IWLYNIIFYFPLDFIKFFIRYALSGRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTL
HGLPLPDTKMFTERTHFTELNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTI
QQAYTV
Download sequence
Identical sequences B9I315
XP_002318614.1.11743 POPTR_0012s07350.1|PACid:18230392 3694.gw1.XII.988.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]