SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0013s03400.1|PACid:18220531 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0013s03400.1|PACid:18220531
Domain Number 1 Region: 89-199,300-418,765-973
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 7.19e-77
Family Calcium ATPase, transmembrane domain M 0.0026
Further Details:      
 
Domain Number 2 Region: 603-817
Classification Level Classification E-value
Superfamily HAD-like 3.35e-35
Family Meta-cation ATPase, catalytic domain P 0.0004
Further Details:      
 
Domain Number 3 Region: 431-619
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.61e-26
Family Metal cation-transporting ATPase, ATP-binding domain N 0.015
Further Details:      
 
Domain Number 4 Region: 199-297
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 6.67e-20
Family Calcium ATPase, transduction domain A 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0013s03400.1|PACid:18220531
Sequence length 982
Sequence
PKRNQRRWKMAYTAIYFIRLLVSLSKNDLDSQTKILGSPSYVAIDVHDDTSPCENKLVSL
INVYQRTLIDMVKEKSLEVLNQLGGVLNVAIILKTDVKYGVGEVDVAHRRDVFGENSYKP
PAKRFLSYILEACKDPTIIILLFCAMMSLGFGIKLHGLRDGWYDGGSIILAAVHLVVVSA
IIKFMKSNQFEKLSRVRNDIKVQVVRDGRQHKISIFDVVVGDVVYLNKGDQIPADGLLFN
DSSLKVDESSMSSEMGHAEVKGRDNPFLLSGSKVAEGNGFMLVTSVGMNTAWGEMMSSRS
HDLDEQTPLRSHLDKIISYTRKVGWTVALLVLVVLLMRYFTRNTRDDSGHYEYNGSKTKI
NDVLDPVVHIIVASATIVVVATPEGLSLALTLTYLYFMKRMMKERVMVRELSACEKMGSA
TTIIINKKDILTLNQMEVVEFFIGEDIIKAKPSNGEIESKVLELLQEGCTSILEISGSPT
EKAILSWAMSHLGINIGEEKKKVEIKHVENFDPEKNGSGVLLVRRNNEKVVRHRKGDAEV
ILAMCSNYYVRNGEIRDVNEDARKQLKEIIRSMAVKSLCCMAFACKEVEDGGQASDELEA
AGFTLLGLVGLKDPCRIEVRTAVESCKNAGVKVILVTGEDVRTARATAIECGVFSCDQED
VESDAIVEGVQFSNYSREQRVERIGKILVMGSSSPSDKLEMIRCLKEEGHVVAVTGGGTN
DALALKEADIELSMGIRGTEVAKESSKIVILDDNFISVVTMLSWGRCFYNNIQKFIQFQL
TMNVAALVINLISACSSGVLSLSAFQMLWEKVIIDTLGLLAVISHDQPTKDLMRKPPVCW
SKRPIDESIFNNILIQVFYQAVTLSALQFNVGKSILGLAINNTLVFNTSVICQVFNIFTA
RLPVEKKSMFMWIRKNKRFLAAVLVVTVAQGVIVELSSKVINSNEKLDRKQWCVSLTIAA
SSWLFDQLVRRMILPKISFLGS
Download sequence
Identical sequences U5FUK3
POPTR_0013s03400.1|PACid:18220531 XP_006375809.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]