SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0013s03590.1|PACid:18220423 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0013s03590.1|PACid:18220423
Domain Number 1 Region: 194-290
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 5.49e-20
Family Calcium ATPase, transduction domain A 0.002
Further Details:      
 
Domain Number 2 Region: 75-191,293-324
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.66e-18
Family Calcium ATPase, transmembrane domain M 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0013s03590.1|PACid:18220423
Sequence length 325
Sequence
MAYKVIYFTRLLVSFSKKDLDSQTEIPGSTSYVAIDVHDDTSPCENKPVSLINVYQRTLI
NMVKEKSLKILNQLGGVSQVAIILETDVKDGVGEVDVAHRRHVFGENSYKKSPSKRFPSY
VLEECKDPTIIILLFCAIMSLGFAIKLHGLRDGWYDGGSIILSTVHLVAVSAISKFMKSN
KFEKLFRVRNDIKVQVVRDRRRRREISIFEVVVGDVVYLNKGDQIPADGLLLNDSSLKVD
ESSMSSEMDHVEVKGRENPFLLSGSQVTDGNGFMLVTSVGMNTAWGEMMSSRSHDLDEQT
PLRSHLDKIVSYMRKVGWTVALFVL
Download sequence
Identical sequences U5FUL6
XP_006375824.1.11743 POPTR_0013s03590.1|PACid:18220423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]