SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0013s03620.1|PACid:18220262 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0013s03620.1|PACid:18220262
Domain Number 1 Region: 75-191,277-398,758-962
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.1e-67
Family Calcium ATPase, transmembrane domain M 0.0046
Further Details:      
 
Domain Number 2 Region: 595-811
Classification Level Classification E-value
Superfamily HAD-like 2.15e-35
Family Meta-cation ATPase, catalytic domain P 0.00038
Further Details:      
 
Domain Number 3 Region: 411-612
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 6.98e-29
Family Metal cation-transporting ATPase, ATP-binding domain N 0.015
Further Details:      
 
Domain Number 4 Region: 191-280
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.66e-16
Family Calcium ATPase, transduction domain A 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0013s03620.1|PACid:18220262
Sequence length 965
Sequence
MAYTAVYFIRLVVSLSKKDLDSQTKSLGSPSYVAIDVHDDTSPCENKRVSLINVYQRTLI
DMVKEKSLEILNQLGGVSQVAIILETDVKDGVGEVDVAHRRDVFGENSYKKSPSKIFLSY
VLEECKDPAIIILLFCAIMSLGFAIKLHGLRDGWYDGGSIILSTVHLVAVSAISKFMKSN
KFEKLSRVRNDIKVQVVRDRRRRDISIFEVVVGDVVYLNKGDQIPADGLLFNDSSLKVDE
SSMSSEMDHVEVKGRENPFLLSGSKVADGNGFMLVTSHDLDEQTPLRSHLDQIISYMRKV
GWTVALYVLVVLLMRNFTRKTRDDSGYYEYNGSKKKINDVLDPVVRIIAAAVAIVVVATP
EGLSSAVTLTYIYFMKRMMKEKVMKPKNQTLSACEKMGSATTIIIDKKDILTLNQMEVVE
FFIGEDIIKAKPSNGEIGSKVLELLQEGAALNTTGTVYKPRSTSILEISGSPTENAILSW
AMSHLGINIAEEKKKVEIKHVGNFDPEKNGSGVLLVRRNNEKVVRHRKGDAEAILAMCSN
YYVRNGEIRDVTEDARKQLKEIIRCMAVKSLCCMAFACKEVEDGGQASDELEAAGFTLLG
LVGLKDPCRIEVRTAVESCKNAGVKVILVTGDDVRTARATAIECGVFSCDQEDVESDAIV
EGVQFSNYSRELRMERIGKILVMGSSSPSDKLEMIRCLKEEGHVVAVTGGGTNDALALKE
ADIVLSMGIRGTEVAKESSQIVILDDNFISVVTMLSWGRCVYNNIQKLIQFQLTIMNVAA
LVISLISACSSGVLSFSAFQILWEKVLIDTLGLLAVISHDQPTKYLMRKPPVCWSKRPIN
ESIFNNILIQVFYQAVTLSALQFNVGKSILGLAINNTLVFNTSVICQVFNIFTARLPVEK
KSMFMWIRKNKRFLAAVLVVTVAQGVIVELSSKVTHSIEKLDRKQWCVSLTVAASSWLFD
QLSCV
Download sequence
Identical sequences U5FTY4
XP_006375827.1.11743 POPTR_0013s03620.1|PACid:18220262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]