SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0014s01500.1|PACid:18223575 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0014s01500.1|PACid:18223575
Domain Number 1 Region: 1-124,237-339,754-990
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 8.76e-133
Family Calcium ATPase, transmembrane domain M 0.00000000608
Further Details:      
 
Domain Number 2 Region: 352-589
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 5.43e-50
Family Metal cation-transporting ATPase, ATP-binding domain N 0.00000887
Further Details:      
 
Domain Number 3 Region: 578-753
Classification Level Classification E-value
Superfamily HAD-like 1.86e-41
Family Meta-cation ATPase, catalytic domain P 0.00000705
Further Details:      
 
Domain Number 4 Region: 124-235
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.32e-28
Family Calcium ATPase, transduction domain A 0.0000832
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0014s01500.1|PACid:18223575
Sequence length 1015
Sequence
MEDAYARSITEVLDFFGVDPGKGLSDSQVALHSKIYGKNVLPEETRTPFWKLVLKQFDDL
LVKILIAAAAVSLVLALINGETGLAAFLEPFVILLILAANAAVGVITETNAEKALEELRA
YQADIATVLRNGCFSILPATELVPGDIVEVSVGCKVPADMRMIEMLSNQLRVDQAILTGE
SCSVEKELESTIATNAVYQDKTNIIFSGTVVVVGRARAVVVGVGANTAMGNIRDSMLRTD
DEATPLKKKLDEFGTFLAKVIAGICILVWIVNIGHFRDPSHGGFLRGAIHYFKIAVALAV
AAIPEGLPAVVTTCLALGTKRMARLNAIVRSLPSVETLGCTTVICSDKTGTLTTNMMSVS
KICAVHSVHRGPTIAEYSVSGTSYAPEGMIFGSSGLQIEFPAQLPCLLHIAMCSAVCNES
ILQYNPDRGIYEKIGESTEVALRVLAEKVGLPGFDSMPSALHMLTKHERASYCNQYWESQ
FKKVSVLEFSRDRKMMSVLCSRKQTKIMFSKGAPESIVSRCSNILCNDDGSTVPLSVAVR
DELESRFHSFAGKETLRCLSLAFKQMPIGQQTLSFEDEKDLTFIGLVGMLDPPREEVRNA
MLSCMTAGIRVIVVTGDNKSTAESLCNKIGAFDHLEDFAGRSYTASEFEELPALQQTLAL
QRMALFTRHACLVTFSFLCFVRVEPSHKRMLVEALQHQNEVVAMTGDGVNDAPALKKADI
GIAMGSGTAVAKSASDMVLADDNFASIVAAVAEGRAIYNNTKQFIRYMISSNIGEVVCIF
VAAVLGIPDTLAPVQLLWVNLVTDGLPAIAIGFNKQDSDVMKVKPRKVNEAVVSGWLFFR
YLVIGAYVGLATVAGFVWWFVYSDTGPKLPYKELMNFDSCSTRETTYPCSIFDDRHPSTV
SMTVLVVVEMFNALNNLSENQSLLVIPPWSNLWLVASIVLTMLLHILILYVHPLSILFSV
TPLSWAEWKVVLYLSFPVIIIDEILKFFSRNSTGLRLGLRFRRPDLLPKRELRDK
Download sequence
Identical sequences B9IBQ1
POPTR_0014s01500.1|PACid:18223575 XP_002320682.1.11743 3694.estExt_fgenesh4_pm.C_LG_XIV0020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]