SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0014s04570.1|PACid:18222736 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0014s04570.1|PACid:18222736
Domain Number 1 Region: 17-134,231-325,639-862
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.62e-85
Family Calcium ATPase, transmembrane domain M 0.0044
Further Details:      
 
Domain Number 2 Region: 327-383,416-637
Classification Level Classification E-value
Superfamily HAD-like 1.14e-38
Family Meta-cation ATPase, catalytic domain P 0.0006
Further Details:      
 
Domain Number 3 Region: 134-231
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.97e-29
Family Calcium ATPase, transduction domain A 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0014s04570.1|PACid:18222736
Sequence length 965
Sequence
MVENSIALDAINKEAVDLENIPLEEVFDNLKCTREGLTANEVRERLDLFGYNKLEEKKES
KLLKFLGFMWNPLSWVMEAAAIMAIGLAHGGNKSADYHDFVGIITLLIINSTISFIEENN
AGNAAAALMARLAPKAKVLRDGRWSEEEASVLVPGDIVSIKLGDIIPADARLLEGDPLKI
DQSALTGESLPVTKSPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVENTTHVGHF
QKVLTAIGNFCICSIAAGMVIEIIVIYGIQERGYRVGIDNLLVLLIGGIPIAMPTVLSVT
MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNMIEVFAKGVDKD
MVVLMAARASRLENQDAIDCAIVSMLADPKEARAGIQEVHFLPFNPTDKRTALTYIDAAG
KMHRVSKGAPEQILHLAHNKTEIERRVHSIIDKFAERGLRSLAVARQGVPAGTKDSPGGP
WEFVGLLPLFDPPRHDSAETIRRALDLGVSVKMITGDQLAIAKETGRRLGMGTNMYPSSS
LLGEGKDDAVGGLPIDELIEKADGFAGVFPEHKYEIVRRLQARKHICGMTGDGVNDAPAL
KKADIGIAVADSTDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRI
VLGFMLLTVFWKFDFPPFMVLVIAILNDGTIMTISKDRVKPSPLPDSWKLSEIFATGVVL
GSYLALMSVVFFWLAYETNFFPEHFNVRDFNQHHFNMTDEKIANPLKEQLASAVYLQVST
ISQALIFVTRSRSWSFRERPGLLLVSAFIIAQLIATVISATATWKFAGIRSIGWGWTAVI
WVYNILTYFLLDPIKFAVRYALSGRAWNNIIDQRTAFTNKKDFGKEARSAAWAAEQRTLH
GLQSAETKMFSERNTFRDINLMAEEAKRRAEIARVRELHTLKGKVESFAKLRGLDIDSMN
QHYTV
Download sequence
Identical sequences U5FSH1
POPTR_0014s04570.1|PACid:18222736 XP_006375124.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]