SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0014s08330.1|PACid:18223584 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0014s08330.1|PACid:18223584
Domain Number 1 Region: 175-231
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000209
Family SNARE fusion complex 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0014s08330.1|PACid:18223584
Sequence length 265
Sequence
MTVIDLVTRVDSICKKFDKYDVDKQKNLNAAGDDAFARLYAVVEADLDAVLQKSEAAKIE
KSRATAVAMNAEIRRTKARLLEEIPKLQRLAFKQVKGLSKEEREVRSDLVAALKDRIEAV
ADGNISAAKQGGDSAPSASHGGIKFDSTYDGRFDDEYFQQTEESDRFRQEYEMRRVKQAS
LDVIAEGLDTLKNMAHDMNEEVDRQVPLMDEIDDKVDRAASDLKTTNVRLKDTINKMRSS
RNFCIDIILLVIILGIAAYLYNVLK
Download sequence
Identical sequences B9I8M5
XP_002320147.2.11743 POPTR_0014s08330.1|PACid:18223584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]