SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0014s09740.1|PACid:18223938 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0014s09740.1|PACid:18223938
Domain Number 1 Region: 7-132,248-358,770-1033
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.18e-135
Family Calcium ATPase, transmembrane domain M 0.0000000379
Further Details:      
 
Domain Number 2 Region: 362-382,552-824
Classification Level Classification E-value
Superfamily HAD-like 3.23e-54
Family Meta-cation ATPase, catalytic domain P 0.0000307
Further Details:      
 
Domain Number 3 Region: 371-616
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.55e-50
Family Metal cation-transporting ATPase, ATP-binding domain N 0.00011
Further Details:      
 
Domain Number 4 Region: 136-244
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.92e-28
Family Calcium ATPase, transduction domain A 0.0000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0014s09740.1|PACid:18223938
Sequence length 1045
Sequence
MEEKPFPAWSWSVEQCLKEFNVKLDKGLSSYEVEKRRERYGWNELAKEKGKPLWWLVLEQ
FDDMLVKILLVAAFISFILAYLHAGESGEAGFEAYVEPLVIVLILALNAIVGVWQETNAE
KALEALKEMQCESGKVLRDGYMMPELPARELVPGDIVELRVGDKVPADMRVAVLKTSTLR
VEQSSLTGEAMPVLKGTAPIFMDDCELQAKENMVFAGTTVVNGSCICIVISTGMKTEIGK
IQKQIHEASLEESDTPLKKKLDEFGGRLTTAIGFACLVVWIINYKNFLSWDVVDGWPTNI
RFSFEKCTYYFKIAVALAVAAIPEGLPAVITTSLALGTRKMAQKNAIVRKLPSVETLGCT
TVICSDKTGTLTTNQMSVTEFFTLGGKTTSSRIFRVEGTTYDPKDGGIVDWTCYNMDANL
QAMAEICAVCNDAGIFCDGRLFRATGLPTEAALKVLVEKMGVPDAKAREKIRDMQLAANY
LIDRSCEWWTKRLKRLATLEFDRIRKSMSIIVREPNGQNRLLVKGAVESLLERSSHVQLA
DGSVVPIDEPCRQLLSLRLLEMSSKGLRCLGLAYKDDLGEFSDYHAENHPAHKKLLDPAY
YMSIESDLVFVGVVGLRDPPREEVHKAIEDCRDAGIRVMVITGDNKSTAEAICKEIKLFD
EGEGLRGRSFTGKEFTALSPSEQMEILSKPGGKVFSRAEPRHKQEIVRMLKDMGEIVAMT
GDGVNDAPALKLADIGIAMGITGTEVAKEASDMVLADDNFSSIVSAVAEGRSIYNNMKAF
IRYMISSNVGEVISIFLTAALGIPECMIPVQLLWVNLVTDGPPATALGFNPADVDIMRKP
PRKCNDALINSWVLFRYLVIGSYVGIATVGIFVLWYTQASFLGINLVSDGHTLVQLSQLR
NWGECPTWSNFTVTPYQVGGGRMITFSNPCDYFSAGKVKAMTLSLSVLVAIEMFNSLNAL
SEDNSLVTMPPWRNPWLLVAMSVSFGLHCVILYVPFLADVFGIVPLSLKEWFLVILVSAP
VILIDEALKFVGRSGRCRAKKEKIA
Download sequence
Identical sequences B9I912
POPTR_0014s09740.1|PACid:18223938 XP_002320213.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]