SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0015s03450.1|PACid:18233528 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0015s03450.1|PACid:18233528
Domain Number 1 Region: 101-171
Classification Level Classification E-value
Superfamily SNARE fusion complex 6.98e-19
Family SNARE fusion complex 0.0016
Further Details:      
 
Domain Number 2 Region: 237-303
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000000393
Family SNARE fusion complex 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0015s03450.1|PACid:18233528
Sequence length 305
Sequence
MFGSKKSPLKISKHTRVDPECPAPSRPNPFDSDDEFDTKKTLKTSRKTSSEPNLTAPCFS
TNPFDGDEERGSSASSTYFLASAARQKYNNDFRDSGGLENQSVQELESYAVYKAEETTKS
VNGCLKIAEDMREGATRTLITLHQQGEQITRTHDAAVEIDHDLSRGEKLLGSLGGMFSKT
WKPKKNRPITGPVITRDASPQRRGNQLEQREKLGLNPAPKGQSSMRTPLPEPTNAFQKVE
LEKSKQDDSLSDLSNILGELKNMAVDMGTEIDRQTNSLDHLQNDVDELNYRVRGANQRGR
RLLGK
Download sequence
Identical sequences B9IE11
POPTR_0015s03450.1|PACid:18233528 3694.estExt_fgenesh4_pg.C_LG_XV0236 XP_002322041.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]