SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0015s07710.1|PACid:18232997 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0015s07710.1|PACid:18232997
Domain Number 1 Region: 17-134,241-335,650-864
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.18e-83
Family Calcium ATPase, transmembrane domain M 0.0059
Further Details:      
 
Domain Number 2 Region: 337-382,428-648
Classification Level Classification E-value
Superfamily HAD-like 8.25e-37
Family Meta-cation ATPase, catalytic domain P 0.00081
Further Details:      
 
Domain Number 3 Region: 134-231
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 6.67e-29
Family Calcium ATPase, transduction domain A 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0015s07710.1|PACid:18232997
Sequence length 967
Sequence
MGEKAEVLEAVLKETVDLENIPIEEVFENLRCSREGLTSQAAEERLSIFGHNKLEEKKER
KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN
AGNAAAALMARLAPKAKVLRDGRWSEQDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI
DQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHF
QKARRYNCYMFFVLTAIGNFCICSIAIGMIIELIVMYPIQDRQYRPGIDNLLVLLIGGIP
IAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLI
EVVFAKGVDADTVVLMAAQASRIENQDAIDTAIVGMLADPKEARAGIQEVHFLPFNPTDK
RTALTYIDSGGIMHRVSKGAPEQILNLAHNKSDIERRVHAVIDKFAERGLRSLAVAYQKV
PEGRKESAGGPWQFIGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRL
GMGTNMYPSSALLGQDKDESIVALPIDELIEKADGFAGVFPEHKYEIVKRLQARKHICGM
TGDGVNDAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNY
TIYAVSITIRIVLGFMLLALIWKFDFPPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWK
LAEIFTTGVVLGSYLAMMTVIFFWAAYKTNFFPRVFGVSTLEKTAHDDFRKLASAIYLQV
STISQALIFVTRSRSWSYVERPGILLVVAFVIAQLIATLIAVYANWSFAAIEGIGWGWAG
VIWLYNIVFYIPLDLIKFIIRYALSGRAWDLVIEQRIAFTTQKDFGKEQRELQWAHAQRT
LHGLQAPDTKMFTERTHFTELNHMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDT
IQQAYTV
Download sequence
Identical sequences B9IEG7
XP_002322127.1.11743 POPTR_0015s07710.1|PACid:18232997 3694.gw1.XV.1202.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]