SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0015s15690.1|PACid:18233024 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0015s15690.1|PACid:18233024
Domain Number 1 Region: 6-121
Classification Level Classification E-value
Superfamily SNARE-like 2.29e-27
Family Synatpobrevin N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 125-192
Classification Level Classification E-value
Superfamily SNARE fusion complex 8.37e-24
Family SNARE fusion complex 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0015s15690.1|PACid:18233024
Sequence length 219
Sequence
MSQKSLIYAFVSRGTVILADYTEFSGNFNSIAFQCLQKLPATNNKFTYNCDGHTFNYLVD
NGFTYCVVAAESAGRQVPIAFLERVKDDFVTKYGGGKAATAQANGLNKEFGPKLKEHMQY
CADHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSQG
TQIRRKMWLQNMKVKLIVLGILIVLILIIVLSICKGFNC
Download sequence
Identical sequences B9ICK8
XP_002322360.1.11743 3694.estExt_fgenesh4_pg.C_LG_XV0909 POPTR_0015s15690.1|PACid:18233024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]