SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0016s01050.1|PACid:18250798 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0016s01050.1|PACid:18250798
Domain Number 1 Region: 3-39,204-319
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 8.11e-26
Family Calcium ATPase, transmembrane domain M 0.005
Further Details:      
 
Domain Number 2 Region: 57-253
Classification Level Classification E-value
Superfamily HAD-like 0.000000000000119
Family Meta-cation ATPase, catalytic domain P 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0016s01050.1|PACid:18250798
Sequence length 341
Sequence
MQEEMPFLMSLCVAYWKRKIMSSGCKGIVQKSSACLTTGFVTTICTDLARKLISQDELEE
TRKAIRDCQTAGVNVKFISQDDISVVRAAAIEFEILTENSEAAMLKGEDFRNFSEEERIG
MVDQITAIGNCLPSDKLLLMQCLKKKGNVVALTGANDLHDTPALRQADIGFVKADWGTKM
ARDYLDLMVWDGTWSPVPNIIRCGRCSYENIQKFIQLELTMILSGLSTTTILTISSGEAL
MTPIQVSRTNLIVPVLGGMAVITEPPGEKLMNKPPVQKTEPLITKAMRRNIIAQVVYQVV
IFVIVQFRGQVFNQFNSIPGRLRRLMCLKTFIRTIGFGWLH
Download sequence
Identical sequences U5FK51
XP_006373593.1.11743 POPTR_0016s01050.1|PACid:18250798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]