SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0016s01070.1|PACid:18249973 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0016s01070.1|PACid:18249973
Domain Number 1 Region: 122-239,332-380,409-459,792-974
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.01e-55
Family Calcium ATPase, transmembrane domain M 0.0033
Further Details:      
 
Domain Number 2 Region: 464-483,600-829
Classification Level Classification E-value
Superfamily HAD-like 1.97e-23
Family Meta-cation ATPase, catalytic domain P 0.0012
Further Details:      
 
Domain Number 3 Region: 487-645
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.0000000000000327
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0038
Further Details:      
 
Domain Number 4 Region: 245-333
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.000000000000876
Family Calcium ATPase, transduction domain A 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0016s01070.1|PACid:18249973
Sequence length 987
Sequence
MKSSSEISQEMDLESQETGPAIPAPRKIFRPVVLVILAVRTFSSKAFNNKESPDSLGVSL
LSPSHRNLEVPEIEEISPTRQVCLDIPSIDEAVNAMSDIKLQLEKIANIVKGRNLQSLNQ
FGGVERVAVVLETDLKNGITGDIEDLSRSRTNAIYKTTVPAARNFLELLMKSGNRYTIFL
LIVSAALSLGFGIKEEGPTTGWYEGVLIILAIIILVIVPAVRDFLGENSENLLGEQRQRR
KREMEVAVLRAGKQLKVPALDLVIGDIVSLERGCPIPGDGLFVSGEYLKLDDSFPSIVNE
QNPFLFYGAKVIEGQGNMMVTSMGLNTTLGEMTSKASKRRLPVQLAKVSNQTEIAGLATS
ILILVVLFLRSKAGKKNEDSSVPEFKGEHKTMEVTELIKRIVWKPSGKISTLTTCLTTFL
VGVVEGVPFFIRLAIYYWNKKIPSTKAVVQEQLTGVTMGSVTAICIDKTSWITMNPPEVD
ECWIDETVTRENSAIRKQVKDAFCIGISMSSGNDQESLISWCASKFGKDYMESLKQRYST
IGMKELCPGEERNAVLLREKEGNETKKFLYWKGLAPKILKMCSRHYNSEGKLVDMDTEKR
SAFEKIINDMQSKDLKTIALAYKTTDDETAEDNRLILIGLLGLKDKCWKETREAVEACRN
AGVNIILVSEDSESVIEDIAKKYGMLSGSSILKHRGETFRSFSDEQRKDVVNKICVMGNS
LPSDKLLLVRCLKQQGHIVAFVGVRTDDAPSLKEADVGVVTGTGSSELVNGSSELIILDG
NLGFLVWILKGGRCIYGNIHNTVTTIFFGYAPMTAIQMIWVNLVVAVLGGLALLTEPPSQ
KLMQRPPIRPTEPFITKAMWRNIIIQASYQVSILLAFQFKGQAILNINEEVSKAMIFSSF
LLCQLSNQFNASEQKMKNLVKGVQQNLWFWVASVLTVVLQVVFIEISHHIFGFARLNGPQ
WSICFLIGALSCLSTKLGLKFITCKIS
Download sequence
Identical sequences B9IH41
XP_002323135.2.11743 POPTR_0016s01070.1|PACid:18249973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]