SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0016s01090.1|PACid:18250941 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0016s01090.1|PACid:18250941
Domain Number 1 Region: 115-233,327-375,404-454,788-987
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.75e-65
Family Calcium ATPase, transmembrane domain M 0.0018
Further Details:      
 
Domain Number 2 Region: 458-480,596-841
Classification Level Classification E-value
Superfamily HAD-like 4.13e-25
Family Meta-cation ATPase, catalytic domain P 0.0016
Further Details:      
 
Domain Number 3 Region: 482-641
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 9.81e-16
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0038
Further Details:      
 
Domain Number 4 Region: 239-327
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.000000000000157
Family Calcium ATPase, transduction domain A 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0016s01090.1|PACid:18250941
Sequence length 1033
Sequence
MDPESLEVGLLGPAIPAPRNVLRSAILVLRAGHVFFSKAYNDKKETLDSPRVLLSSPSHR
NLVVAEIEEISPTHQVSLDATHNDEVGNATSDIKLQHENIANIVKGRDLDSLHAFGGVRG
IAEAFETDLENGITGEIEDLSRRRTNAIYKTTVPAARNFLELLMKYSNRHTIFLLIVSAA
LSLGFGITEEGPRTGWYEGVLIILAIIILVIVPAVRDFLGENSENLLGEQRQRRKREMEV
NVLRGGKRLKVRALDLVIGDIVSLEWGCPIPGDGLFVSGEYLKLDDSFPSIVNKHNPFLF
YGSKVIEGQGNMLVTSMGLNTTLGEMISKASKSRRLPVQLDKVSKHTEIAGLATSILILV
VLFLRFKLGKEKEDLSLPEIKGEHKTKEVMELIKRIVWKPSGKISTLTTCLTTFLVGVVE
GVPFFISLAIYYWNKKIPSTKAVVQEQLTGVTMGSVTTICFDKTSWLTMNLQEFEVDECW
IDETVIRENSAIHEQVKDAFCIGISTSSGNDQESLISWCERKFGINMESLKQSYTIIGMK
ELSPGDEGNGVLVREKEGNETKKFLYWKGLAPKILKMCSRHYNSEGKLVDMDTEKRSAFE
KIINDMQSKHLKTIALAYKTTDDENPEDDRLILIGLLGLKDKCWKETIEAVEACRNAGVN
ILLVSEDSESVIEDIAQKYGMLSGPGILEHGGETFRSFSDEERKDVVNKICVMGNSLPSD
KLLLVRCLKQQGHIVAFVGVRTDDAPSLKEADVGIVTGTGSRELVNGSAELIILDGNLGY
LVWILKGGRCIYGNIHKYIQVEVTITISGLVISTVTTIFFGYAPMTAIQMIWVNLVVAVL
GGLALLTEPPSQKLMQRPPIRPTEPFITEAMWRNIIIQASYQVSILLAFQFKGQAILNIN
EDVSKAMIFSSFLLCQLSNQFNASEQKLKNLVKGVQQNLWFWVASVLTVVLQVVFIEISH
DIFGFARLNGPQWGICFLIGALSCVTDGAANITWCVIKVKLRRSSSLAGSELPQSTSILE
LPLIAENSSPTAS
Download sequence
Identical sequences B9IH43
POPTR_0016s01090.1|PACid:18250941 XP_002323137.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]