SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0016s02990.1|PACid:18249936 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0016s02990.1|PACid:18249936
Domain Number 1 Region: 140-210
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000000179
Family SNARE fusion complex 0.0044
Further Details:      
 
Weak hits

Sequence:  POPTR_0016s02990.1|PACid:18249936
Domain Number - Region: 22-199
Classification Level Classification E-value
Superfamily t-snare proteins 0.0115
Family t-snare proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0016s02990.1|PACid:18249936
Sequence length 243
Sequence
MSRFYDPAIRGAMSTPSASWMQEFNEASKLGDEINGMISGKNSLPSSGPETQRHLSASRR
KITILRTKLDILQSLLSELPSKQPITGKEMNRRQDMLKNLSTKVNQMASILNMSSAANRE
NLLGPDKKTDDIMNRATGLNNHGLVGFQRQIMKEQDQGLEKLEETVISTKHIALAVNEEL
SLHTRLLDDLDEHVDVTNSRLQMVQRKLAFLNKSTKGGCSCWILLVIAVVILIVVIWQLF
QHL
Download sequence
Identical sequences U5FMN0
XP_006373682.1.11743 POPTR_0016s02990.1|PACid:18249936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]