SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0016s02990.2|PACid:18249937 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0016s02990.2|PACid:18249937
Domain Number 1 Region: 128-198
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000000161
Family SNARE fusion complex 0.0044
Further Details:      
 
Weak hits

Sequence:  POPTR_0016s02990.2|PACid:18249937
Domain Number - Region: 11-186
Classification Level Classification E-value
Superfamily t-snare proteins 0.00968
Family t-snare proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0016s02990.2|PACid:18249937
Sequence length 231
Sequence
MSTPSASWMQEFNEASKLGDEINGMISGKNSLPSSGPETQRHLSASRRKITILRTKLDIL
QSLLSELPSKQPITGKEMNRRQDMLKNLSTKVNQMASILNMSSAANRENLLGPDKKTDDI
MNRATGLNNHGLVGFQRQIMKEQDQGLEKLEETVISTKHIALAVNEELSLHTRLLDDLDE
HVDVTNSRLQMVQRKLAFLNKSTKGGCSCWILLVIAVVILIVVIWQLFQHL
Download sequence
Identical sequences U5FJX0
XP_006373681.1.11743 POPTR_0016s02990.2|PACid:18249937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]