SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0016s03000.1|PACid:18251094 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0016s03000.1|PACid:18251094
Domain Number 1 Region: 128-198
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000000698
Family SNARE fusion complex 0.004
Further Details:      
 
Weak hits

Sequence:  POPTR_0016s03000.1|PACid:18251094
Domain Number - Region: 30-100
Classification Level Classification E-value
Superfamily t-snare proteins 0.0029
Family t-snare proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0016s03000.1|PACid:18251094
Sequence length 231
Sequence
MASPSELWMQEFNEASKLGDEISNMISGKNSLPQSGPETQRHLSAIRRKATILTTKLDSL
QSLLLALPGKQPISGKEINRRQEMLKNLSTKVNQMSTALNMAGAANRENLLGSDSKTDDI
IYRASGLDNQGLVGFQRQTMREQDEGLEKLDETVTSTKHIALAVNEELTLHTRLLDDLDE
HVDVTNSRMQRVQRNLAFLNKRTKSGCACWIFLVIAIVILIVVVLVLIKYL
Download sequence
Identical sequences U5FKE1
POPTR_0016s03000.1|PACid:18251094 XP_006373683.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]