SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0016s04240.3|PACid:18250777 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0016s04240.3|PACid:18250777
Domain Number 1 Region: 86-202,302-413
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.44e-52
Family Calcium ATPase, transmembrane domain M 0.001
Further Details:      
 
Domain Number 2 Region: 425-629
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 5.45e-48
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0037
Further Details:      
 
Domain Number 3 Region: 610-746
Classification Level Classification E-value
Superfamily HAD-like 1.69e-35
Family Meta-cation ATPase, catalytic domain P 0.0005
Further Details:      
 
Domain Number 4 Region: 205-300
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 5.62e-27
Family Calcium ATPase, transduction domain A 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0016s04240.3|PACid:18250777
Sequence length 752
Sequence
MMFAALSIAFYVFTLFVKFPIFAAEKIRTALYVRKAARLFLNAENAAGRPECKISDEIKE
AGFGIDPDELASVVREHDIKCLKTNGGVDGIAQKVSVSLDEGVHTSDVSTRQKIYGFNRY
KEKPPRSFLMFVWEALRDLTLIILMICALVSIGVGIATEGWPKGMYDGLGIILSIFLIVM
VTAISDYNQSLQFRDLDREKKKISIQVIRDGRRQEISIYDLVVGDVVQLSIGDIVPADGI
YISGYSLEIDESSLSGESEPVNIYESKPFLLSGTKVQDGSGKMIVTAVGMRTEWGKLMET
LNEGGEDETPLQVKLNGVATIIGKIGLAFAVLTFLVLTGRFLVEKAIHKEFTDWSSSDAL
TLLNYFAIAVTIIVVAVPEGLPLAVTLSLAFAMKKLMDEKALVRHLSACETMGSATCICT
DKTGTLTTNHMEVDKIWICEKIEDIKCSNSESILEMEISESVLSLLFQVIFQNTACEISK
DENGKNKILGTPTEKALFELGLLLGGDFDSQRKEFQMLNVEPFNSVRKKMSVLVALPGGE
LRAFCKGASEIVLKMCDKILDDSGKVVPLSEEQILNISDVINSFASDALRTLCLAYKDLD
DPVYEGSIPDFGYTLVAVVGIKDPVRPGVKDAVQTCLAAGITVRMVTGDNINTAKAIAKE
CGILTEDGVAIEGPEFRIMSPQQMREIIPKIQVMARSLPLDKHTLVTNLKNMFKEVVAVT
GDGTNDAPALHEADIGLAMGIAGTEVCCKRKC
Download sequence
Identical sequences U5FKI9
POPTR_0016s04240.3|PACid:18250777 XP_006373728.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]