SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0016s08960.1|PACid:18250244 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0016s08960.1|PACid:18250244
Domain Number 1 Region: 165-230
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000000198
Family SNARE fusion complex 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0016s08960.1|PACid:18250244
Sequence length 265
Sequence
MSVIDILTRVDAICNKYDKYDIEKQKDLNVSGDDAFARLYAAIDSDIEAAHQKAELASKE
KSKASAVAINAELRRTKARLLEEVPKLQRLAVKKVKGLSTEELAARNDLVLALPDRIQAI
PDGTAAAPKQTGGWGTSAPRAEIKFDSDGQFDNEYFQETETSSQFRQEYEMRKMKQDQGL
DMISDGLDTLKNMAHDMNEEIDRQVPLMDEIDTKVDKAAADLKNTNVRLKDTVNQLRSSR
NFCIDIVLLIIILGIAAYLYNVLKK
Download sequence
Identical sequences B9IJ24
XP_002322868.1.11743 3694.estExt_fgenesh4_pg.C_LG_XVI0751 POPTR_0016s08960.1|PACid:18250244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]