SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0016s12510.1|PACid:18250148 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0016s12510.1|PACid:18250148
Domain Number 1 Region: 42-96
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000105
Family SNARE fusion complex 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0016s12510.1|PACid:18250148
Sequence length 104
Sequence
MATKSSNEVQSKKREKRTGRENLLGYGEETKPRSRNLGEIVAKYRKSKDASSLATSAKNK
LVQRQEKLGKINNQTEELEGNSEDYASLANELLKKMEKRKWWQI
Download sequence
Identical sequences B9IGA8
XP_002323586.2.11743 POPTR_0016s12510.1|PACid:18250148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]