SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0016s12520.1|PACid:18251017 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0016s12520.1|PACid:18251017
Domain Number 1 Region: 38-227,255-290,481-570
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.05e-23
Family WD40-repeat 0.019
Further Details:      
 
Domain Number 2 Region: 255-341,403-431,502-716
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000116
Family WD40-repeat 0.02
Further Details:      
 
Domain Number 3 Region: 1051-1105
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000000382
Family SNARE fusion complex 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0016s12520.1|PACid:18251017
Sequence length 1115
Sequence
MLSAKRLIQKAVLLHHHQNNEERSSLTAADFDLQVVIHYGIPSTASLLAFDPIQRLLAIA
TLDGRIKVIGGDGIEALFTSPKQLPYKNIEFLQNQGFLISISIENDIQVWNLESRCLACS
LQWELNITAFSVISRSCFMYIGDEHGSMSVLKYDSEDAKLLWLPYRITADSLKEAAGFPS
PDHQPIVGVLPQPHSSGNRVLIAYQNGLIVLWDVSEGQILFVGGGKDLQLKDDSKNEADP
NIPKDTSHHHLEEKEITALSWASSKGSILAVGYLDGDILFWKTSTTSSTRGQKNESTNSN
IVKLQLSSAEKRLPIIVLHWSTSDRPSNDGDGRLFIYGGDEIGSEEVLTVLTLEWSSRME
TVRYVGRMDITLAGSFADMILLPSSGPTEGNPKAAVSVLANPGQLHLFDDASLSALPSRQ
KHKASVLTMGFPMVVPTVDPPITVAKFITLPSGGNSSKMFSEIASATKRGSTPFQGGSAN
WPLTGGVPSHLSFTEHTGVERVYIAGYLDGSVRLWDATYPALSLICIVEGEVESIEVAGF
SDPVTNLDFCSLTLSLAVGNKCGLVRIYNLDGSSDETTFHFLIDTKHEVHTMPQGKGPPL
RAVFSLLNSPILALQFANYGAKLAVGLECGRVVVLDTSSLAVLFSTESVSSSCSPVISVN
WVECINTCSLVKSPKHSDSNMPINPTEQVMFFLTKDATLYMIDGGTGSMISSHPWHPKKK
SVAISMYVIDGSPSVPGLTDGKQLESDQNFIAKNESEHTTTSTGISSHNNEHHSSVNTLT
REKLLDSFILLCCEDSLHLYSTKNVIQGNNKTICKVKHAKPCCWASTFRKQGNICGVVLL
FQSGVIEIRSFSGLELVKETSLMSVLRWNFKANMEKMMSCDNGQITLAHGCELAFISLFS
GENCFRIPESLPCLHDKVLAAAANAAFNFSSNQKKKQGTKPGILGGIVKGFKGGKVDHSV
EITLNPKSDFSHLEGAFSKQPFSDSYRTAVDSEEVVELNIDDIEIDEPSLPTATTSSQDV
KHMKREKWSEREQLLGATDDMKPKLRTPEEIMAKYRKAGDAASVAAHARKKLVERQEKLE
RISRRTEELQSGAEDFSSMANELVKLMEKRKWWQI
Download sequence
Identical sequences B9IGA9
XP_002323587.2.11743 POPTR_0016s12520.1|PACid:18251017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]