SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0016s14500.1|PACid:18250953 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0016s14500.1|PACid:18250953
Domain Number 1 Region: 64-151,293-430,927-1145
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 6.28e-54
Family Calcium ATPase, transmembrane domain M 0.035
Further Details:      
 
Domain Number 2 Region: 431-447,716-924
Classification Level Classification E-value
Superfamily HAD-like 1.24e-36
Family Meta-cation ATPase, catalytic domain P 0.039
Further Details:      
 
Domain Number 3 Region: 442-477,510-722
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 8.94e-17
Family Metal cation-transporting ATPase, ATP-binding domain N 0.013
Further Details:      
 
Domain Number 4 Region: 147-218,251-288
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.4e-16
Family Calcium ATPase, transduction domain A 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0016s14500.1|PACid:18250953
Sequence length 1173
Sequence
MLHNDNNTTFSASLEISRDSGNLGKPKGRSRRKSVQFDEGVLREEDARFIYINDPRRTND
QYEFTGNEIRTSKYTLITFLPKNLFIQFHRVAYLYFLAIAALNQLPPLAVFGRTVSLFPL
LFVLCVTAIKDGYEDWRRHRSDRNENNREALVLQCGQFRSKEWKRIRAGEVLKISADETI
PCDMVLLGTSDPSGVAYIQTMNLDGESNLKTRFAKQEASLAVLEGGAISGLIRCEQPNRN
IYEFTANMEFNGQKFSLSQSNIVLRGCQLKNTGWIIGVVVYAGQETKAMLNSAASPSKRS
KLEAYMNRETLWLSIFLFMMCLVVAVGMGLWLSRYENQLDYLPYYRKRYLTPGKDYGKRY
KFYGIPMEIFFSFLSSIIVFQIMIPISLYITMELVRIGQSYFMIGDRHMYDSSSNSRFQC
RSLNINEDLGQIRYVFSDKTGTLTENKMEFQRASVNGKNYGGSLLTADQLLEENVSGATT
NRRWKLKSTIAVDSELLELLHKDLVGDERIVAHEFFLALAACNTVVPIRTHDGFSSCTDC
QFFEDVETIDYQGESPDEQALVAAASAYGYTLFERTSGHIVIDVNGEKLRFGVLGMHEFD
SVRKRMSVVIRFPNNAVKVLVKGADTSVLSILAKDSGIDDRARRAATQSHLTEYSSQGLR
TLVIAARDLTEEELELWQCRFDDASTSLTDRAAKLRQTAALIECDLNLLGATAIEDKLQE
GVPEAIESLRQAGIKVWVLTGDKQETAISIGLSCKLLVPDMEQIIINGNSENECRKLLAD
AKAKCGLKPSNKGSQYLTCNKNAEIDHLERPERKEEAPISLIIDGNSLVYILEKELESDL
FDIATYCKVVLCCRVAPLQKAGIVDLIKSRTDDMTLAIGDGANDVSMIQMADVGVGICGQ
EGRQAVMASDFAMGQFRFLNRLLLVHGHWNYQRMGYLVLYNFYRNAVFVLMLFWYILFTA
FSTTSALTDWSSVLYSVVYTSVPTIVVGVLDKDLSHRTLLRYPKIYGVGYRHEAYNKRLF
WVTMADTLWQSLVLFGIPVIVYKESTIDIWSIGNLWTVAVVIIVNVHLAMDVRRWVSITH
IAVWGSVIVAFACVVVLDSIPIFPNYGTIYHLAKSPTYWLTIFLTIVIGLLPHFLFKLVH
HHFWPSDIQIAREAEILRRGPDYWVSKPVGGSS
Download sequence
Identical sequences B9IGU6
POPTR_0016s14500.1|PACid:18250953 XP_002323676.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]