SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0017s02270.1|PACid:18209743 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  POPTR_0017s02270.1|PACid:18209743
Domain Number - Region: 348-397
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00219
Family SNARE fusion complex 0.0072
Further Details:      
 
Domain Number - Region: 234-311
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0188
Family Seryl-tRNA synthetase (SerRS) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0017s02270.1|PACid:18209743
Sequence length 592
Sequence
MGSYSQILFLVILISLTLRCQSWGWFSSSTETLSTDNSQTNGLPRGSVVEFSMNGLSDGK
GMKLVEKAERKMVGTNSCWQNAYQNLFAGCSQILAVEEKRWRLAWHLSDCFQKDSGRPAF
PYCDTKSAMVNCLKRLNDNEHKVYLEFSLETNSICYQLQAHAFNHKMERLVNDLKNSAEY
TEEQLEIIGGKTHVLLQRSNQIQDSLSSIDIQVENVAQTTKDAKDHMDVLSKHSEAVYKH
SKEIAHSQSELQEGQAKMNENLKEGMSMLHDAYTNLGQEVDNVRNEAVEIEKQIGRVGDT
MSSKMETLQNSANDIENMAGKSLDKQKQLLDGQSNALKGLQLLTQFQSEALEESRSTLQH
FAEYGHKQQEELLQQQEQLQKVHDHLVENSNSILAAQEAFESKQASMFIALEKLFALQNA
MLLESRIIKAFILYTASIFIVYMFTSTKQTYTIRARLYVGLAATFLVEVAMLRLTTNSIE
RQTWLINVFRLLYGILASIQFLHAIFTYRDYEVLNHHLILNLMDKINVMQKTRELSWETD
SDVDWSSWIQTELAEGGDNLEDPDFMVPEEVAENSITASMTRTYDLRCRQRR
Download sequence
Identical sequences U5FLN6
POPTR_0017s02270.1|PACid:18209743 XP_006372505.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]