SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0017s12360.2|PACid:18209757 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0017s12360.2|PACid:18209757
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily t-snare proteins 1.8e-25
Family t-snare proteins 0.00056
Further Details:      
 
Domain Number 2 Region: 130-189
Classification Level Classification E-value
Superfamily SNARE fusion complex 2.27e-17
Family SNARE fusion complex 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0017s12360.2|PACid:18209757
Sequence length 220
Sequence
MNEIFEGYERQYCELSANLSRKCTAALALDREQKKQKISEIRAGLEDAESLIRKMDMEAR
NLQPNVKAVLLAKLREYKSDLNNLKTEVKRIGSGNLNASARDELLEAGMANSLTASADQR
SRLMMTTERLNQSGDRIKDSRRTMLETEELGVSILQDLHQQRQSLLHAHDTLHGVDGNIG
KSKRVLTAMSRRINKNKWIIGAVIAVLVVVISLILYFKLK
Download sequence
Identical sequences A9P9H7
XP_002324075.1.11743 XP_006373341.1.11743 POPTR_0017s12360.1|PACid:18209756 POPTR_0017s12360.2|PACid:18209757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]