SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0018s03700.1|PACid:18215268 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0018s03700.1|PACid:18215268
Domain Number 1 Region: 18-135,232-326,640-850
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.83e-88
Family Calcium ATPase, transmembrane domain M 0.0044
Further Details:      
 
Domain Number 2 Region: 328-384,413-638
Classification Level Classification E-value
Superfamily HAD-like 1.32e-39
Family Meta-cation ATPase, catalytic domain P 0.00079
Further Details:      
 
Domain Number 3 Region: 135-232
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.14e-28
Family Calcium ATPase, transduction domain A 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0018s03700.1|PACid:18215268
Sequence length 954
Sequence
MSSKGGISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGATRLQVFGPNKLEEKKE
SKILKFLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVINSTISFIEEN
NAGNAAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLK
IDQSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH
FQKVLTAIGNFCICSIAIGIIIEIVVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSV
TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFAKGVEK
EHVMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNN
GNWHRASKGAPEQILTLCNCKEDVKRKVHSVIDKFAERGLRSLGVAKQEVPEKSKDAPGA
PWQLVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS
SLLGQDKDAAIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPA
LKKADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIR
IVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFSTGVV
LGGYLALMTVLFFWIMKDTDFFSDKFGVRSLRDSKYEMMAALYLQVSIVSQALIFVTRSR
SWSFVERPGLLLVSAFVVAQLIATLIAVYANWGFAHIKGCGWGWAGVIWLFSLVTYLPLD
VLKFAIRYILSGKAWDNFLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPAQTNTIFS
DKSSYRELSEIAEQAKRRAEMARLRELNTLKGHVESVVKLKGLDIDTIQQHYTL
Download sequence
Identical sequences B9ILG8
XP_002324397.1.11743 POPTR_0018s03700.1|PACid:18215268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]