SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0018s08380.1|PACid:18214471 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0018s08380.1|PACid:18214471
Domain Number 1 Region: 548-567,637-871
Classification Level Classification E-value
Superfamily HAD-like 4.4e-44
Family Meta-cation ATPase, catalytic domain P 0.0013
Further Details:      
 
Domain Number 2 Region: 341-432
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.31e-25
Family Calcium ATPase, transduction domain A 0.0032
Further Details:      
 
Domain Number 3 Region: 551-643
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 3.17e-17
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0061
Further Details:      
 
Domain Number 4 Region: 72-129
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.000000000183
Family HMA, heavy metal-associated domain 0.0027
Further Details:      
 
Domain Number 5 Region: 285-321,433-543,814-853
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000824
Family Calcium ATPase, transmembrane domain M 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0018s08380.1|PACid:18214471
Sequence length 889
Sequence
MINNLLLVVSPKPKLCFARTSKFNFDSVHFNANLSKRRRLALRPRAFPKFTLSSSLQTET
DLENAAFQAPKNNNSPILLDVTGMMCGACVSRVKSILSADERVESAVVNMLTETAAVKLK
PEALLEGEVSASIGESLAKRLSECGFEAKKRVSGNGVAENVKKWKDMVKKKEELIVKSRN
RVVFAWTLVALCCGSHASHILHSLGIHVGHGSVLEVLHNSYVKGGLALGSLLGPGRDLLV
DGLRAFKKGSPNMNSLVGFGSIAAFVISAISLLNPALEWDASFFDEPVMLLGFVLLGRSL
EEKARIRASSDMNELLALMSTQSRLVITPSDSNSPTENVLCSDAICTEVPTDDVRVGDTL
LVLPGETIPVDGRVLAGRSVVDESMLTGESLPVFKEEGLKVSAGTINWDGPLRVEALSTG
SNSTISRIIRMVEDAQGSEAPIQRLADSIAGPFVYSVMTVSAATFAFWYYIGSHVFPDVL
LNDIAGPDGDPLLLSLKLSVDVLVVSCPCALGLATPTAILVGTSLGAKQGLLIRGGDVLE
RLASISYVALDKTGTLTEGKPAVSAVASISYEESEILQMAFAVERTALHPIAKAIVNKAE
SLKLTIPETRGQLTEPGFGTLAEVDGRLVAVGSLDWVNERFQRRTKLSDLKDLETKVTYQ
SSEGMPSSNYSKTVVYVGREGEGIIGAIAISDCLRHDAESTISRLQQKGINTVLLSGDRE
EAVATIANRVGIESEFINASLTPQKKSEVISSLQAAGHRVAMVGDGINDAPSLALADVGI
AIQNEAQENAASDVASIILLGNRLAQVVDALDLSRATMAKVYQNLSWAIAYNVVAIPIAA
GVLLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQLHRSETGRNRERST
Download sequence
Identical sequences U5FG13
XP_006372043.1.11743 POPTR_0018s08380.1|PACid:18214471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]