SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0018s09750.1|PACid:18215136 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0018s09750.1|PACid:18215136
Domain Number 1 Region: 16-133,230-324,638-848
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.14e-88
Family Calcium ATPase, transmembrane domain M 0.0064
Further Details:      
 
Domain Number 2 Region: 326-636
Classification Level Classification E-value
Superfamily HAD-like 1.57e-39
Family Meta-cation ATPase, catalytic domain P 0.00087
Further Details:      
 
Domain Number 3 Region: 133-230
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.24e-29
Family Calcium ATPase, transduction domain A 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0018s09750.1|PACid:18215136
Sequence length 952
Sequence
MEKATSLEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGASRIQIFGPNKLEEKKESK
FLKFLGFMWNPLSWVMEAAAIMAIALANGSGKPPDWQDFVGIICLLVINSTISFIEENNA
GNAAAALMAGLAPKTKVLRDGKWTEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKID
QSALTGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
KVLTAIGNFCICSIAVGMVIELVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTM
AIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDH
VVLLAARASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGN
WHRASKGAPEQILDLCNAREDVKKKTHSCMDKFAERGLRSLAVARQQVPEKSKESPGGPW
EFVGLLNLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASL
LGQHKDASIASLPVEELIEKADGFAGVFPEHKYEIVKKLQESKHIVGMTGDGVNDAPALK
KADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIV
FGFMLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLG
GYLALMTVIFFWAVHDTDFFSNKFGVRSLRHHDEEMMGALYLQVSIVSQALIFVTRSRSW
SFIERPGLLLLSAFMLAQLVATLIAVYANWGFARIKGIGWGWAGVIWIYSIVFYFPLDIM
KFAIRYILSGKAWLNLLDNKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETAGIFNEK
SSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV
Download sequence
Identical sequences B9ILW8
POPTR_0018s09750.1|PACid:18215136 3694.eugene3.00180800 XP_002325038.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]