SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0018s11900.1|PACid:18215582 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0018s11900.1|PACid:18215582
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily SNARE-like 3.43e-42
Family Synatpobrevin N-terminal domain 0.00026
Further Details:      
 
Domain Number 2 Region: 133-197
Classification Level Classification E-value
Superfamily SNARE fusion complex 4.92e-20
Family SNARE fusion complex 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0018s11900.1|PACid:18215582
Sequence length 199
Sequence
MKITALLVLKVNPEGSDPVILANACDVSHFGYFQRSSVREFIVFVGRTVAKRTPPGQRQS
VQHEEYKVHAYNRNGLCALGFMDDHYPVRSSFSLLDKVIEEYQKNFGESWRTAQADSSQP
WPYLNEALTKFQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSA
ASQMFYKQAKKTNQCCTIL
Download sequence
Identical sequences B9IMG6
XP_002324554.2.11743 XP_011017987.1.28252 POPTR_0018s11900.1|PACid:18215582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]