SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0018s12040.1|PACid:18215216 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0018s12040.1|PACid:18215216
Domain Number 1 Region: 14-132,229-323,637-846
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.83e-87
Family Calcium ATPase, transmembrane domain M 0.0059
Further Details:      
 
Domain Number 2 Region: 325-373,418-635
Classification Level Classification E-value
Superfamily HAD-like 1.32e-37
Family Meta-cation ATPase, catalytic domain P 0.00078
Further Details:      
 
Domain Number 3 Region: 132-229
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 8.24e-28
Family Calcium ATPase, transduction domain A 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0018s12040.1|PACid:18215216
Sequence length 949
Sequence
MGDVSLEQIKNENIDLERIPVEEVFDQLRCTREGLTSAQGEERLKIFGPNKLEEKKECKF
LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAG
NAAAALMAGLAPKTKVLRDGKWSEQDAAILVPGDLISIKLGDIIPADARLMEGDPLKIDQ
SALTGESLPVTKNPGDGIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNNVGHFQK
VLTAIGNFCICSIAIGMLIEIIVMYPIQNRRYREGIDNLLVLLIGGIPIAMPTVLSVTMA
IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDMDRDTL
LLHAARAARIENQDAIDASIVGMLGDPKEARADITEVHFLPFNPVEKRTAITYYDSKGDW
YRSSKGAPEQIIDLCQLEGEMEKKAHEIIDNFADRGLRSLGVARQTIPEKNKESEGGPWE
FVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLL
GNSKDEGIAGIPVDELIEKADGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKK
ADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVL
GFLLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGT
YMSIMTVVFFWLVHDTDFFSEKFGVRSIRGKPDELTAALYLQVSIISQALIFVTRSRSWS
FVECPGLLLVGAFIAAQLMATIIAVYATWSFARIQGVGWGWAGIIWIYSIITYIPLDILK
FIIRYALTGKAWDNLLQNKTAFTTKKDYGKGEREAQWATAQRTLHGLQPPETMFNDKTTY
RELNELAEQAKKRAEVARLRELHTLKGHVDSVVKMKGLDIETIQQHYTV
Download sequence
Identical sequences B9IMI1
XP_002324564.1.11743 POPTR_0018s12040.1|PACid:18215216 3694.fgenesh4_pg.C_LG_XVIII000977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]