SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0018s12620.1|PACid:18215158 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0018s12620.1|PACid:18215158
Domain Number 1 Region: 3-120
Classification Level Classification E-value
Superfamily SNARE-like 3.48e-29
Family Synatpobrevin N-terminal domain 0.028
Further Details:      
 
Domain Number 2 Region: 122-190
Classification Level Classification E-value
Superfamily SNARE fusion complex 1.41e-18
Family SNARE fusion complex 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0018s12620.1|PACid:18215158
Sequence length 222
Sequence
MGILYGMVARGPVVLAEFSSIAQTNANTVARQILDKIPRGNEDSNSSYSHDRYIFHVKRT
DDLTVLCMADDATGRRIPFEFLEDIHQRFVKTYGRAIHTSAPYAMNEEFSRIMSQQMDHF
SNDPNADRLNRLQGEMSHVRSVMIDNIDKVLQRGDRLALLVEKTSTLQGNTIRFRRQTQR
FRNTQWWRNFKLKATLILFLLIFIYTVLALFCHGPSLHSCLK
Download sequence
Identical sequences B9IMU4
POPTR_0018s12620.1|PACid:18215158 XP_002325198.1.11743 3694.eugene3.00181126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]