SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0018s13360.1|PACid:18215312 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  POPTR_0018s13360.1|PACid:18215312
Domain Number - Region: 142-192
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0109
Family SNARE fusion complex 0.0095
Further Details:      
 
Domain Number - Region: 21-75
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 0.068
Family Glutamyl tRNA-reductase dimerization domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0018s13360.1|PACid:18215312
Sequence length 239
Sequence
MGISKTEINLRRLLSSAPQQQNQAKLVHYIATLREQLEQLAEERTADELPRVSKAVLNDY
SEKIEAIASKLVNSLPEIEAPQETFAGDSGKESPKADGGDQIAPSPGLRRRFAPVSNFED
KTRDSIKADASAPVKLDAAAQAHIEKHRKLQDDLTDEMVGLAQQLKESSLLMSQSLQNTE
KILDSTEQAVEQSLASTGHANVRTMDIYSKTSKTTCFTWLLMFLMTCIFIMVVLLIRVT
Download sequence
Identical sequences B9IN18
3694.estExt_fgenesh4_pg.C_LG_XVIII1135 XP_002324665.1.11743 POPTR_0018s13360.1|PACid:18215312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]