SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0018s13650.2|PACid:18215063 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0018s13650.2|PACid:18215063
Domain Number 1 Region: 156-275,375-493,857-955
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.83e-94
Family Calcium ATPase, transmembrane domain M 0.00097
Further Details:      
 
Domain Number 2 Region: 497-517,649-912
Classification Level Classification E-value
Superfamily HAD-like 6.59e-57
Family Meta-cation ATPase, catalytic domain P 0.00031
Further Details:      
 
Domain Number 3 Region: 506-704
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 4.58e-37
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0064
Further Details:      
 
Domain Number 4 Region: 277-372
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.45e-24
Family Calcium ATPase, transduction domain A 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0018s13650.2|PACid:18215063
Sequence length 972
Sequence
MTSLFKGSPCIRQQDDLEAGENRSTDVGRDANSSSGPFDIVSTKNAPIDSLRRWRKAALV
LNASRRFRYTLDLKKEEEKRRILSKIRAHAQVIWAAHLFKEAGNNRGIVSCWKIVGILFL
GRDTEPHPPPTGDFGISVGQISVITRDHDHNALEALGGVKGVADALKTDIEKGIHEDDAD
LLKRKNAFGSNTYPQKKGRSFWMFLWEAWQDLTLIILMVAAVASLVLGMKTEGVKEGWYE
GASIAFAVILVIVVTAISDYKQSLQFQNLNEEKRNIHLEVTRGGRRVEVSIYDIVAGDVI
PLNIGDQVPADGILITGHSLAIDESSMTGESKIVQKNSREPFLMSGCKVADGSGTMLVTG
VGINTEWGLLMASISEDNGEETPLQVRLNGVATFIGIVGLTVALLVLVVLLVRYFTGHTK
NFDGSPEFVAGKTKVSKAVDGAVKILTVAVTIVVVAVPEGLPLAVTLTLAYSMRKMMRDK
ALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAFSGGKKMDLPESKSQLPPILSSLL
IEGIAQNTTGSVFVPEGGGDLEISGSPTEKAIMGWAIKLGMNFDAVRSESNVIHVFPFNS
EKKKGGVALQLPNSQVHIHWKGAAEIVLASCTKYVDASGNTVPLDQDKVSFFKKAIEDMA
CSSLRCVSIAYRTYDMDKVPADEQQLAQWVIPQDDLVLLAIIGIKDPCRPGVRDAVRLCQ
NAGVKVRMVTGDNPQTAKAIALECGILSSEEDAVEPNVIEGRVFREYSDSEREDIAEKIS
VMGRSSPNDKLLLVQALKRRGHVVAVTGDGTNDAPALHEADIGLSMGIQGTEVAKESSDI
IILDDNFASVVKVVRWGRSVYANIQKFIQFQLTVNVAALIINVVSAMSSGEVPLNAVQLL
WVNLIMDTLGALALATEPPTDHLMNRSPVGRREPLITNIMWRNLLVQVRFSVWFYSIYLV
NINTSNCYKFSA
Download sequence
Identical sequences U5FKS1
XP_006372180.1.11743 POPTR_0018s13650.2|PACid:18215063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]