SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0018s13660.1|PACid:18214604 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0018s13660.1|PACid:18214604
Domain Number 1 Region: 80-196,296-414,778-991
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.22e-102
Family Calcium ATPase, transmembrane domain M 0.0011
Further Details:      
 
Domain Number 2 Region: 418-438,570-831
Classification Level Classification E-value
Superfamily HAD-like 2.2e-49
Family Meta-cation ATPase, catalytic domain P 0.00047
Further Details:      
 
Domain Number 3 Region: 427-625
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 8.17e-35
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0098
Further Details:      
 
Domain Number 4 Region: 198-291
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.83e-21
Family Calcium ATPase, transduction domain A 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0018s13660.1|PACid:18214604
Sequence length 1082
Sequence
QAALVLNNSRRFRYTLDLKKEEEKKRIEKAHARARRYGTTTSYPSPIGDFGISQEQLSEI
TRDHNHNALVEIGGVSLPQVKGVADALKTNLEKGIHGDHADLLKRKSAFGSNTYPQKKGK
SLWIFLGEACQDPTLIMLMIAAVVSIGLGMKTDGIKKGWYDGASIAFAVIVGVVVTAIND
YRQDLQFNFLIEKKRNIHLEVIRDGRRPKVSIFDVVVGDVVPLKIGDQIPAGGILIPGCS
LDIDQSSMTGESKIVHKNSREPFLMSGCKVVDGSGTMLVSSVGVNTKWGLLMASTSEDTG
EETPLQVYLNGVATFIGSVGLALAAAVLVVLSVRFFTGHTKNLDGRVQFREGNTSAADAI
NGATKILAVSVATAVVAVPEGLPLAVTLILSFLVKKLLAENALVRRLSACETMGSMTTIC
TDKTGTLTSNSMTVMEVYVAGQKIDPPDSKSLLSPMLSSLVIEGIARNTTASVFIPEGEG
DPVISGSPTEKAIVEWGFKLGMDFDAVRSESSVISVFLFNSEKKKGGVALQLPDSQVHIH
WKGAAEIILASCVGYCDANGNLVQMDKDKELLFKNVIEDMAANSLRCIALAYKTYDMDKL
PVDEQELAQWPLPEDDLVLLALIGLKNPCHPGVGDAVRTCQNAGIKVRMVTGDNPQTAKA
IALECGILSSEEDAVEPNVIEGRVFREYSDSEREDIAEKISVMGRSSPNDKLLLVQALIR
RGHVVAVTGDGTNDAPALHEADIGLSMGSQGTQVTKEASDIVLLDDNFSSIPKVVLWGRS
IYVNIQKFKQFQLTIIVASVIINAVGAASGGVQLNTVQLLWVNLVMDTLGAWALVTEPPT
DNLMRMPPVGRREPLITNILWRNLLFQVAYQVTVLLVLNFRGKSLLGLEHEIPQHANKVK
NTLIFNAFVLCQIFNEVNSRKPDELNIFKGILKSHLFIGINAVTLLLQVIIIEFGGKFTS
TVRLNWKMWLISVAIAFMSWPLAFIGKFIPVPKSPLHKFFTRRFHRGRRAHDYNQSLEMC
ISFLTASLNFSFTGLPGSVVVLDLNQGVYLKLCKSSIYMRTHMEREGGGGQSGDGFEQSR
VS
Download sequence
Identical sequences B9IN46
XP_002325252.2.11743 POPTR_0018s13660.1|PACid:18214604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]