SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0018s14140.1|PACid:18215205 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0018s14140.1|PACid:18215205
Domain Number 1 Region: 58-135
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.000000000017
Family Metal cation-transporting ATPase, ATP-binding domain N 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0018s14140.1|PACid:18215205
Sequence length 158
Sequence
MPAGVAVIPLALRVHNRDHRFYLALVVFVSACPCALILSTPGGYYLETLGKIKAMAFDKT
GTITKGEFVVTDFQHLCDDISLYTLLYWVSSIESKSSHPMAAVLVDYGRWHSVEPKPEDL
VEFQNFPGEGIQGKNEVKNICIDSREIAHRASGTGKKP
Download sequence
Identical sequences B9IN88
XP_002325272.2.11743 POPTR_0018s14140.1|PACid:18215205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]