SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0018s14690.1|PACid:18214333 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  POPTR_0018s14690.1|PACid:18214333
Domain Number - Region: 322-424
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0196
Family Calcium ATPase, transmembrane domain M 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0018s14690.1|PACid:18214333
Sequence length 440
Sequence
MVLCNNLSFNTNQSQNPPRNRNSLTKSYRLLLQFGNKSRGFCGVVANAKKKGENHSKRKR
GWWQRFFIDEEGNWLGLKDDDMLDAEAELSENSSDEELSEEEKFEAWKRRAEAIVDLREA
QEDMLNEESRKWEDWIVDYGDNGHDDDSNGSWWSKEYDGNGGIGNGGSVEDVRSDPTDLV
REKGFVESVRDLVFGREEEDLLYEDRVFRYASLNSAKFLAVLIIIPWALDFAVHDYVLMP
FLDRYVKTVPLAAQMLDVRKNQKLEMIKEIKLEKARLKLEVEIGKSPPLSDEEEWRELRH
KALELRDEWRLENRRSFANIWSDMVFGVSIFVLLYFNQSKVALLKFTGYKILNNVSDTGK
AFLIILITDIFLGYHSESGWQTLLEVIFEHYGLEVDQSAITIFICLVPVVIDACVKLWLF
KYLPRLSPKVANIFREMKRH
Download sequence
Identical sequences B9N815
POPTR_0018s14690.1|PACid:18214333 XP_006372256.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]